PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g16290.1.p
Common NameBRADI_4g16290, LOC100838422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 281aa    MW: 30765.7 Da    PI: 7.2026
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g16290.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd  lv +++q+G+g+W++++++ g+ R+ k+c++rw +yl
  Bradi4g16290.1.p 16 KGPWTPEEDIVLVSYIQQHGPGNWRSVPEHTGLMRCSKSCRLRWTNYL 63
                      79********************************************97 PP

2Myb_DNA-binding47.54.2e-1569114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Bradi4g16290.1.p  69 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 114
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8041167IPR017930Myb domain
SuperFamilySSF466891.31E-3013110IPR009057Homeodomain-like
SMARTSM007171.5E-131565IPR001005SANT/Myb domain
PfamPF002492.5E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-241770IPR009057Homeodomain-like
CDDcd001672.02E-121863No hitNo description
PROSITE profilePS5129419.14868118IPR017930Myb domain
SMARTSM007172.4E-1368116IPR001005SANT/Myb domain
PfamPF002492.3E-1369114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2471118IPR009057Homeodomain-like
CDDcd001674.49E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRPPCCDNG GAGVKKGPWT PEEDIVLVSY IQQHGPGNWR SVPEHTGLMR CSKSCRLRWT  60
NYLRPGIKRG NFTPHEEGII IHLQALLGNK WAAIASYLPQ RTDNDIKNYW NTHLKKKVKR  120
LQQQTTHPAD HSFQQQTTTA PNAASATTSS NYYNPISSSN LEATTQAMAY RDTTPGSEVT  180
TIGTVSKLFQ TWMAKAPPPA VAQDYKAMVT MQEFQQDQEA RPAGFVITGD ITSHGEADQS  240
AAATFSLLEN WLLDDMAPGQ AAMDGLMDMS ASCCAGPIMF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1108441e-139AK110844.1 Oryza sativa Japonica Group cDNA clone:002-172-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577454.10.0PREDICTED: transcription factor MYB30-like
TrEMBLI1IL280.0I1IL28_BRADI; Uncharacterized protein
STRINGBRADI4G16290.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.16e-80myb domain protein 60